oraldesign.com.coSites sharing an IP address

Choose a server

Sharing an IP is normal for shared hosting and CDNs — it doesn't mean these sites are related to oraldesign.com.co.

Sites on 147.79.79.98
Domain	Report
fiberkasa.com.tr	Report → for fiberkasa.com.tr
waffleconsulting.com	Report → for waffleconsulting.com
audataagency.com	Report → for audataagency.com
bestisocertification.online	Report → for bestisocertification.online
guianow.com	Report → for guianow.com
targomkt.tech	Report → for targomkt.tech
duifarma.link	Report → for duifarma.link
ultradryerventclean.site	Report → for ultradryerventclean.site
cuetoseisdedos.com	Report → for cuetoseisdedos.com
airimmigrationonline.com	Report → for airimmigrationonline.com
thedryerventsshieldsweepsystems.site	Report → for thedryerventsshieldsweepsystems.site
investgrupo.io	Report → for investgrupo.io
gcemantevirtual.com	Report → for gcemantevirtual.com
ekopoli.fi	Report → for ekopoli.fi
glintvanity.site	Report → for glintvanity.site
gdindia.in	Report → for gdindia.in
marketingfuse.agency	Report → for marketingfuse.agency
zeroclickincome.net	Report → for zeroclickincome.net
24news.click	Report → for 24news.click

Showing the first 20 sites we know on this address.

Sharing an IP is normal for shared hosting and CDNs — it doesn't mean these sites are related to oraldesign.com.co.

Sites on 88.223.87.53
Domain	Report
3genassetlocators.com	Report → for 3genassetlocators.com
flychoose.com	Report → for flychoose.com
tlwastoria.com	Report → for tlwastoria.com
jstrscitcomputerclasses.blog	Report → for jstrscitcomputerclasses.blog
mura.africa	Report → for mura.africa
anvistore.online	Report → for anvistore.online
hepatoburn-com.store	Report → for hepatoburn-com.store
alwanparts.com	Report → for alwanparts.com
upsomein.com	Report → for upsomein.com
vacayallday.io	Report → for vacayallday.io
bluemaxwholesale.com	Report → for bluemaxwholesale.com
centroclinicosanramon.cl	Report → for centroclinicosanramon.cl
yavara.sbs	Report → for yavara.sbs
metodovip.net	Report → for metodovip.net
giraasorte.bet	Report → for giraasorte.bet
netflow.com.tw	Report → for netflow.com.tw
kalatmakdesign.com	Report → for kalatmakdesign.com
grupowebargentina.com.ar	Report → for grupowebargentina.com.ar
webelon168.com	Report → for webelon168.com

Showing the first 20 sites we know on this address.