swkripashankartiwarimahavidyalaya.org.in Overview - Basic Information
- Website / Domain
- swkripashankartiwarimahavidyalaya.org.in
- TLD
- ORG.IN
- WhoIs Registrar
- whois.registry.in
- Category
- N/A
- IP Address
- 51.210.113.215
- No associated domains found.
- 51.210.113.215
- Created on
- 2024-01-24T03:55:08
- Updated on
- 2025-03-10T04:55:09
- Expires on
- 2026-01-24T03:55:08
- HTTPS
- SSL Start Date
- 2015-06-04T04:04:38
- SSL Expire Date
- 2035-06-04T04:04:38
- Page Load Time
- N/A
- favicon
- PageSpeed Score
- Google PageSpeed Score Insights
- Search Engine
- Google Indexed | Bing Indexed | Yahoo Indexed
- Cached View
- Google Web Cache | Archive.org Cache | Live Version
- Archive.org Last Cache
- N/A
swkripashankartiwarimahavidyalaya.org.in report was last analyzed
Saturday, April 26, 2025 at 7:20 UTC
CubDomain.com is not promoting, linking to, or is affiliated with swkripashankartiwarimahavidyalaya.org.in in any way. We are just collecting data from different companies and providing estimated data for analysis purposes, not modifying any information.
Traffic Analytics for swkripashankartiwarimahavidyalaya.org.in
Daily
Visitors
N/A
Monthly
Visitors
N/A
Pages per
Visit
N/A
Visit
duration
N/A
Bounce
Rate
N/A
Global
Rank
N/A
Visitors by Country Demographics
Country Code | Percentage | Visits | Desktop | Mobile |
---|
Gender Distribution Insights
Age Distribution Data
Search domain and compare pricing
Search your domain name in 2159 top-Level Domain and buy the best value domain name.
Simply click the button below to add it.
Safety Analysis of swkripashankartiwarimahavidyalaya.org.in
- Google Safe Browsing
View Report
- Norton SafeWeb
View Report
- McAfee SiteAdvisor
View Report
- Bitdefender TrafficLight
View Report
- Yandex Infected
View Report
- WOT Safety Status
- SUSPICIOUS
- WOT Safety Reputation
- 0 / 100
- WOT Safety Confidence
- 0 / 100
- WOT Child Safety Reputation
- 0 / 100
- WOT Child Safety Confidence
- 0 / 100
- WOT Categories
Generate XML Sitemap Free
Please paste full URL of your website
Hosting Details for swkripashankartiwarimahavidyalaya.org.in
IP | 51.210.113.215 | ||
---|---|---|---|
Country Name | Country Code | EUR | |
Continent Name | N/A | Region Name | Hauts-de-France |
Capital | Paris | City Name | Roubaix |
Latitude | 50.693712 | Longitude | 3.174439 |
Zip Code | 59689 | Time Zone | +01:00 |
Currency Code | EUR | Currency Name | Euro |
CIDR | 51.210.0.0/16 | ASN | 16276 |
AS | OVH SAS | Language Name | French |
Other Sites on 51.210.113.215 (swkripashankartiwarimahavidyalaya.org.in's IP)
- No associated domains found.
Technologies Utilized on swkripashankartiwarimahavidyalaya.org.in
SSL Certificate Validation for swkripashankartiwarimahavidyalaya.org.in
An SSL (Secure Sockets Layer) certificate is a digital certificate that establishes a secure encrypted connection between a web server and a user's browser. It encrypts data transmitted over the internet, preventing unauthorized access or interception by malicious third parties.
- Chain: 2
- SAN: NA
- Serial Number: 008210CFB0D240E3594463E0BB63828B00
- Signature Algorithm: NA
- Issued Date: 2015-06-04T04:04:38
- Expires Date: 2035-06-04T04:04:38
- Issued By:
- Common Name: ISRG Root X1
- Organization: Internet Security Research Group
- Organization Unit: NA
- Country: US
- Locality: NA
- State: NA
- Issued For: ISRG Root X1
- Common Name: Internet Security Research Group
- Organization: NA
- Organization Unit: NA
- Country: US
- Locality: NA
- State: NA
- Chain: 1
- SAN: NA
- Serial Number: 008A7D3E13D62F30EF2386BD29076B34F8
- Signature Algorithm: NA
- Issued Date: 2024-03-12T17:00:00
- Expires Date: 2027-03-12T15:59:59
- Issued By:
- Common Name: ISRG Root X1
- Organization: Internet Security Research Group
- Organization Unit: NA
- Country: US
- Locality: NA
- State: NA
- Issued For: R11
- Common Name: Let's Encrypt
- Organization: NA
- Organization Unit: NA
- Country: US
- Locality: NA
- State: NA
- Chain: 0
- SAN: NA
- Serial Number: 033174A50F23B7F572515548BB37C7D880BA
- Signature Algorithm: NA
- Issued Date: 2025-03-10T19:13:56
- Expires Date: 2025-06-08T19:13:55
- Issued By:
- Common Name: R11
- Organization: Let's Encrypt
- Organization Unit: NA
- Country: US
- Locality: NA
- State: NA
- Issued For: swkripashankartiwarimahavidyalaya.org.in
- Common Name: NA
- Organization: NA
- Organization Unit: NA
- Country: NA
- Locality: NA
- State: NA
Verify HTTP/2 Support for swkripashankartiwarimahavidyalaya.org.in
Verifying HTTP/2 Support is crucial as it ensures that the website benefits from the improved speed and efficiency offered by the HTTP/2 protocol. It enables faster loading times, multiplexing, header compression, and enhanced security features, contributing to a better user experience.
swkripashankartiwarimahavidyalaya.org.in's Whois Information
Domain Name: swkripashankartiwarimahavidyalaya.org.in Registry Domain ID: DCAC5B5E725FA44AE9D5E5353D3A6E454-IN Registrar WHOIS Server: Registrar URL: https://www.crazydomains.com Updated Date: 2025-03-10T11:55:09Z Creation Date: 2024-01-24T11:55:08Z Registry Expiry Date: 2026-01-24T11:55:08Z Registrar: Dreamscape Networks International Pte Ltd Registrar IANA ID: 1219 Registrar Abuse Contact Email: [email protected] Registrar Abuse Contact Phone: +61.894220890 Domain Status: ok http://www.icann.org/epp#OK Registry Registrant ID: REDACTED FOR PRIVACY Registrant Name: REDACTED FOR PRIVACY Registrant Organization: Registrant Street: REDACTED FOR PRIVACY Registrant Street: REDACTED FOR PRIVACY Registrant Street: REDACTED FOR PRIVACY Registrant City: REDACTED FOR PRIVACY Registrant State/Province: Uttar Pradesh Registrant Postal Code: REDACTED FOR PRIVACY Registrant Country: IN Registrant Phone: REDACTED FOR PRIVACY Registrant Phone Ext: REDACTED FOR PRIVACY Registrant Fax: REDACTED FOR PRIVACY Registrant Fax Ext: REDACTED FOR PRIVACY Registrant Email: Please contact the Registrar listed above Registry Admin ID: REDACTED FOR PRIVACY Admin Name: REDACTED FOR PRIVACY Admin Organization: REDACTED FOR PRIVACY Admin Street: REDACTED FOR PRIVACY Admin Street: REDACTED FOR PRIVACY Admin Street: REDACTED FOR PRIVACY Admin City: REDACTED FOR PRIVACY Admin State/Province: REDACTED FOR PRIVACY Admin Postal Code: REDACTED FOR PRIVACY Admin Country: REDACTED FOR PRIVACY Admin Phone: REDACTED FOR PRIVACY Admin Phone Ext: REDACTED FOR PRIVACY Admin Fax: REDACTED FOR PRIVACY Admin Fax Ext: REDACTED FOR PRIVACY Admin Email: Please contact the Registrar listed above Registry Tech ID: REDACTED FOR PRIVACY Tech Name: REDACTED FOR PRIVACY Tech Organization: REDACTED FOR PRIVACY Tech Street: REDACTED FOR PRIVACY Tech Street: REDACTED FOR PRIVACY Tech Street: REDACTED FOR PRIVACY Tech City: REDACTED FOR PRIVACY Tech State/Province: REDACTED FOR PRIVACY Tech Postal Code: REDACTED FOR PRIVACY Tech Country: REDACTED FOR PRIVACY Tech Phone: REDACTED FOR PRIVACY Tech Phone Ext: REDACTED FOR PRIVACY Tech Fax: REDACTED FOR PRIVACY Tech Fax Ext: REDACTED FOR PRIVACY Tech Email: Please contact the Registrar listed above Name Server: ns1.websbook.co.in Name Server: ns2.websbook.co.in DNSSEC: unsigned URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/ >>> Last update of WHOIS database: 2025-04-26T19:20:56Z <<< For more information on Whois status codes, please visit https://icann.org/epp Access to .IN WHOIS information is provided to assist persons in determining the contents of a domain name registration record in the .IN registry database. The data in this record is provided by .IN Registry for informational purposes only ,and .IN does not guarantee its accuracy. This service is intended only for query-based access. You agree that you will use this data only for lawful purposes and that, under no circumstances will you use this data to (a) allow, enable, or otherwise support the transmission by e-mail, telephone, or facsimile of mass unsolicited, commercial advertising or solicitations to entities other than the data recipient's own existing customers; or (b) enable high volume, automated, electronic processes that send queries or data to the systems of Registry Operator or a Registrar, or NIXI except as reasonably necessary to register domain names or modify existing registrations. All rights reserved. .IN reserves the right to modify these terms at any time. By submitting this query, you agree to abide by this policy.
HTTP Headers of swkripashankartiwarimahavidyalaya.org.in
HTTP headers are essential data snippets exchanged between web servers and browsers during online interactions. They convey crucial information about content, security, caching, and server details, impacting website performance and user experience.
Ping Status for swkripashankartiwarimahavidyalaya.org.in
Ping is a network diagnostic tool used that works by sending an Internet Control Message Protocol (ICMP) Echo Request to a specified interface on the network and waiting for a reply.
Generate robots.txt Free
Please paste full URL of your website
DNS Records for swkripashankartiwarimahavidyalaya.org.in
A Records
DNS A record maps a domain name to an IPv4 address for network communication and web hosting purposes.
Type | Domain | Address | TTL |
---|---|---|---|
No records found. |
AAAA Records
DNS AAAA records map domain names to IPv6 addresses for network communication and web hosting in the DNS system.
Type | Domain | Address | TTL |
---|---|---|---|
No records found. |
CAA Records
CAA record allows domain owners to specify which certificate authorities (CAs) are allowed to issue SSL/TLS certificates for their domain.
Type | Domain | Record | TTL |
---|---|---|---|
No records found. |
SOA Records
SOA record (Start of Authority) stores administrative information about a DNS zone, including the primary nameserver, contact email, and various timing parameters.
Type | Domain Name | Primary NS | Responsible Email | TTL |
---|---|---|---|---|
No records found. |
MX Records
MX records (Mail Exchanger) specify the mail servers responsible for receiving emails for a domain, enabling proper email delivery.
Type | Domain Name | Preference | Address | TTL |
---|---|---|---|---|
No records found. |
TXT Records
TXT records (Text records) contain additional textual information associated with a domain, commonly used for DNS-based verification, SPF, DKIM, and other purposes.
Type | Domain Name | Record | TTL |
---|---|---|---|
No records found. |
NS Records
NS records (Name Server) specify the authoritative DNS servers responsible for a domain, indicating where DNS information can be obtained for that domain.
Type | Domain Name | Canonical Name | TTL |
---|---|---|---|
No records found. |
DNSKEY Records
DNSKEY records store the public key used for DNSSEC (DNS Security Extensions) to provide authentication and integrity for DNS data.
Type | Domain Name | Algorithm | Protocol | Key | TTL |
---|---|---|---|---|---|
No records found. |